DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and bmp1a

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001035126.1 Gene:bmp1a / 572452 ZFINID:ZDB-GENE-060818-1 Length:986 Species:Danio rerio


Alignment Length:272 Identity:77/272 - (28%)
Similarity:121/272 - (44%) Gaps:65/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRF--RPYEQGDKHWLLIKGNYSGCW 163
            ||: |||..:| |:...:|:.:|..:..:|.:.:...||:.|  |..|:.   :::......||.
Zfish   116 ERV-WPEGVIP-YVISGNFSGSQRAIFRQAMRHWEKHTCVTFIERTTEES---YIVFTYRPCGCC 175

  Fly   164 SSVGRRSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFN 227
            |.||||.|| |.:::. ..|...|:|||||.|.:||:|:.:..:|||:|.|..:||..|..:||.
Zfish   176 SYVGRRGGGPQAISIG-KNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQPGQEYNFL 239

  Fly   228 KYARTHITNFGVEYDYQSVMHYSSRAFSK-------------NGKATIEPLDPYASLGQRRGLSD 279
            |.....:.:.|..||:.|:|||:...||:             ||   :.|     .:|||..||.
Zfish   240 KMEPGEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNG---VRP-----PIGQRTRLSK 296

  Fly   280 KDVSKLNEMYE--------QDCS---------------------------EDYLLNFDRFGNYID 309
            .|:::..::|:        |:.|                           |..:|||.....|..
Zfish   297 GDIAQARKLYKCPRCGDSLQESSGNFSSPGYPNGYSAYMHCIWRISVTPGEKIILNFTSMDLYRS 361

  Fly   310 ELLDYFQGNIQD 321
            .|..|....|:|
Zfish   362 HLCWYDHVEIRD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 66/241 (27%)
ZnMc_astacin_like 110..289 CDD:239807 60/194 (31%)
bmp1aNP_001035126.1 ZnMc_BMP1_TLD 112..309 CDD:239808 66/206 (32%)
Astacin 117..309 CDD:279708 65/205 (32%)
CUB 311..420 CDD:278839 11/63 (17%)
CUB 424..533 CDD:278839
FXa_inhibition 544..576 CDD:291342
CUB 580..699 CDD:278839
FXa_inhibition 706..741 CDD:291342
CUB 746..855 CDD:278839
CUB 859..972 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.