Sequence 1: | NP_573318.1 | Gene: | CG6696 / 32856 | FlyBaseID: | FBgn0030947 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035126.1 | Gene: | bmp1a / 572452 | ZFINID: | ZDB-GENE-060818-1 | Length: | 986 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 77/272 - (28%) |
---|---|---|---|
Similarity: | 121/272 - (44%) | Gaps: | 65/272 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 ERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRF--RPYEQGDKHWLLIKGNYSGCW 163
Fly 164 SSVGRRSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFN 227
Fly 228 KYARTHITNFGVEYDYQSVMHYSSRAFSK-------------NGKATIEPLDPYASLGQRRGLSD 279
Fly 280 KDVSKLNEMYE--------QDCS---------------------------EDYLLNFDRFGNYID 309
Fly 310 ELLDYFQGNIQD 321 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6696 | NP_573318.1 | Astacin | 104..295 | CDD:279708 | 66/241 (27%) |
ZnMc_astacin_like | 110..289 | CDD:239807 | 60/194 (31%) | ||
bmp1a | NP_001035126.1 | ZnMc_BMP1_TLD | 112..309 | CDD:239808 | 66/206 (32%) |
Astacin | 117..309 | CDD:279708 | 65/205 (32%) | ||
CUB | 311..420 | CDD:278839 | 11/63 (17%) | ||
CUB | 424..533 | CDD:278839 | |||
FXa_inhibition | 544..576 | CDD:291342 | |||
CUB | 580..699 | CDD:278839 | |||
FXa_inhibition | 706..741 | CDD:291342 | |||
CUB | 746..855 | CDD:278839 | |||
CUB | 859..972 | CDD:278839 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |