DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and hce2l1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_009302797.1 Gene:hce2l1 / 564183 ZFINID:ZDB-GENE-070912-147 Length:232 Species:Danio rerio


Alignment Length:213 Identity:85/213 - (39%)
Similarity:114/213 - (53%) Gaps:10/213 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFEGDIMLHRELLRNGLLNERLTWPEAAVPF----YIDPQDFNANQTMVILKAFKEYHDRTCIRF 142
            |.||||:..........|.:...||:|...|    ||....::....:.|.....:....||::|
Zfish    19 LREGDILSPGSRSAITCLGDSCRWPKAVDGFVYVPYIMSTLYDDMDRITIETGMLDISSSTCVKF 83

  Fly   143 RPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATER 207
            .| .....::|.|:..| ||||.:|...|.|.::|.:|.|:..||..|||:|||||.|:||.::|
Zfish    84 VP-RTHQANFLNIQPRY-GCWSYLGMTGGSQTVSLQSPGCMWSGVASHELMHALGFVHEQSRSDR 146

  Fly   208 DEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPL-DPYASL 271
            |.||.|.||||::...|||.||   ...|....|||.|||||...|||::|..||.|. |||..:
Zfish   147 DRYVSILWENIIENQRHNFRKY---ETNNLNTAYDYSSVMHYGRYAFSEDGGPTIIPKPDPYIPI 208

  Fly   272 GQRRGLSDKDVSKLNEMY 289
            |||.|.|..|:.|:|.:|
Zfish   209 GQRDGPSILDIHKINILY 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 79/191 (41%)
ZnMc_astacin_like 110..289 CDD:239807 75/183 (41%)
hce2l1XP_009302797.1 Astacin 41..229 CDD:279708 79/191 (41%)
ZnMc_hatching_enzyme 47..228 CDD:239810 76/185 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.