DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and mep1a.1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001025452.1 Gene:mep1a.1 / 553530 ZFINID:ZDB-GENE-041001-209 Length:598 Species:Danio rerio


Alignment Length:262 Identity:104/262 - (39%)
Similarity:145/262 - (55%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AVPPAARWGANMQMLRRHNSPAFNFWTEDSDTNIWEHCGLFEGDIMLHRELLRNGLLNERLTWPE 107
            |||.::|      :....:.|.||.:     .|:.....|.||||.|...  |.||:|....| :
Zfish    18 AVPLSSR------VHEVEDEPNFNPF-----INLGAKTRLIEGDIALPPG--RIGLINTTYRW-K 68

  Fly   108 AAVPFYI-DPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLI-KGNYSGCWSSVGRRS 170
            ..:|:.: |..|.||..  .|.:||:.|..::|:.|:||| |:|.::.. ||:  ||||.||.:.
Zfish    69 FPIPYILSDSLDLNAKG--AIYQAFEVYRLKSCVDFKPYE-GEKTYIKFEKGD--GCWSFVGDQQ 128

  Fly   171 GGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHIT 235
            .||||:|. |.|....|:.|||||||||||.||..:||:||||..:.:::|..||||||..:.:|
Zfish   129 NGQVLSLG-PGCDHKAVIEHELLHALGFYHMQSRQDRDDYVKIWLDQVIEGLEHNFNKYDDSFVT 192

  Fly   236 NFGVEYDYQSVMHYSSRAFSKNGK-ATIEPLDP--YASLGQRRGLSDKDVSKLNEMYEQDCSEDY 297
            :....|||:|||||...||:|:.. .||....|  |..:||....|:.|:.:||.||  :||...
Zfish   193 DLNTPYDYESVMHYRPFAFNKDPSIPTITTNIPEFYKIIGQYLDFSEMDIVRLNRMY--NCSSSL 255

  Fly   298 LL 299
            .|
Zfish   256 TL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 84/195 (43%)
ZnMc_astacin_like 110..289 CDD:239807 80/183 (44%)
mep1a.1NP_001025452.1 ZnMc 26..251 CDD:294052 97/240 (40%)
Astacin 65..253 CDD:279708 84/196 (43%)
MAM 261..420 CDD:279023
MAM 261..419 CDD:99706
MATH 419..582 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4243
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.