DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and c6ast3

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001013544.1 Gene:c6ast3 / 541399 ZFINID:ZDB-GENE-050320-99 Length:255 Species:Danio rerio


Alignment Length:230 Identity:79/230 - (34%)
Similarity:123/230 - (53%) Gaps:33/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MLHR------------ELLRNGLLNER---------LTWPEAA-----VPFYIDPQDFNANQTMV 126
            :|||            :||.:..:||:         ..||:.:     || |:....:::.:..:
Zfish    31 LLHRANRGIIPEADEPKLLDDIAVNEKNADPCTSYGCLWPKYSDGKIYVP-YVIANHYSSRELEI 94

  Fly   127 ILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHE 191
            |.:....:...|||||.| ...::.::.|:.. |||:|.|||:...|.::|....|:.|..|.||
Zfish    95 IQRGLDSFSYSTCIRFFP-RGNERDYISIESR-SGCYSYVGRQGYAQTVSLARSGCLYHSTVQHE 157

  Fly   192 LLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSK 256
            |||||||.|:|:..:||.::::.||||||...:||||   .:..|.|..|||.|||.|...||||
Zfish   158 LLHALGFNHEQTRNDRDNHIQVIWENILDDMKYNFNK---VNTLNQGTPYDYSSVMQYERYAFSK 219

  Fly   257 NGKATIEPL-DPYASLGQRRGLSDKDVSKLNEMYE 290
            ||..|:.|: :..|:||....:|..|:.::|.:|:
Zfish   220 NGLPTMIPIPNNNAALGTSTEMSQNDIIRINRLYQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 72/193 (37%)
ZnMc_astacin_like 110..289 CDD:239807 69/179 (39%)
c6ast3NP_001013544.1 Astacin 68..255 CDD:279708 72/193 (37%)
ZnMc 74..255 CDD:294052 70/187 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595461
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.