DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and tll1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001008039.1 Gene:tll1 / 493401 XenbaseID:XB-GENE-479941 Length:495 Species:Xenopus tropicalis


Alignment Length:293 Identity:98/293 - (33%)
Similarity:147/293 - (50%) Gaps:42/293 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LICFWS-ALALALSATLEASTPATRKALLRARPAVPPAARWGANMQMLRRHNSPAFNFWTEDSDT 74
            |.|... :|.|.||.||  .||       :::....||..                |.:|:....
 Frog    10 LFCLMGLSLTLPLSGTL--PTP-------KSQDGKDPADN----------------NLYTDIMKA 49

  Fly    75 NIWEHCGLFEGDIMLHRELLRNGLLNERLTWPEAA-----VPFYIDPQDFNANQTMVILKAFKEY 134
            |.........|||.|..:  ||.:......||:::     ||:.:. .|::.::...|..|.|||
 Frog    50 NQKSKKLRIHGDIALKTD--RNAINCTECLWPKSSDGFVYVPYTVS-SDYSQDEVNAITTAMKEY 111

  Fly   135 HDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFY 199
            ...||::|.|: .|:..:|.|: :..||||.:|...|.|.::|....|..:|.|.|||.||||||
 Frog   112 EGLTCVQFTPW-TGEDDYLAIQ-SLDGCWSYIGYYGGSQAVSLLKGFCAYNGGVQHELNHALGFY 174

  Fly   200 HQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSK-NGKATIE 263
            |:.:.::||:||.|.::.|...:..||:|.:   ..|.||:|||.|::||:..|||. :|:.||.
 Frog   175 HEHNRSDRDDYVTIMYQYISPENIGNFDKIS---TNNLGVDYDYSSILHYAGNAFSNTSGQNTIV 236

  Fly   264 P-LDPYASLGQRRGLSDKDVSKLNEMYEQD-CS 294
            | .:|...:||..|||:.||.|:|.:|..| ||
 Frog   237 PHPNPNVPIGQSYGLSNLDVLKINRLYGCDECS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 77/199 (39%)
ZnMc_astacin_like 110..289 CDD:239807 71/180 (39%)
tll1NP_001008039.1 ZnMc_hatching_enzyme 83..265 CDD:239810 72/187 (39%)
CUB 269..379 CDD:238001 1/1 (100%)
CUB 382..494 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.