DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and tll1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_571085.1 Gene:tll1 / 474335 ZFINID:ZDB-GENE-041020-1 Length:1022 Species:Danio rerio


Alignment Length:219 Identity:67/219 - (30%)
Similarity:110/219 - (50%) Gaps:31/219 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 WPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKH-WLLIKGNYSGCWSSVGR 168
            ||...:| |:...:|..:|..::.:|.:.:..:||:.|  .|:.|:. :::......||.|.|||
Zfish   166 WPGGVIP-YVIGGNFTGSQRAMLKQAMRHWEKQTCVTF--IEKTDEESYIVFTYRPCGCCSYVGR 227

  Fly   169 RSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYART 232
            |..| |.:::. ..|...|:|||||.|.:||:|:.:..:||::|.|..:||..|..:||.|....
Zfish   228 RGNGPQAISIG-KNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPG 291

  Fly   233 HITNFGVEYDYQSVMHYSSRAFSK-------------NGKATIEPLDPYASLGQRRGLSDKDVSK 284
            .:.:.|..||:.|:|||:...||:             ||   :.|     ::|||..||..|:|:
Zfish   292 DVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENG---VRP-----AIGQRTRLSKGDISQ 348

  Fly   285 LNEMYE-QDCSEDYLLNFDRFGNY 307
            ..::|. ..|.|...   |..||:
Zfish   349 AKKLYRCPACGETLQ---DSVGNF 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 63/205 (31%)
ZnMc_astacin_like 110..289 CDD:239807 59/193 (31%)
tll1NP_571085.1 ZnMc_BMP1_TLD 157..356 CDD:239808 62/201 (31%)
Astacin 164..357 CDD:279708 62/202 (31%)
CUB 358..467 CDD:278839 5/15 (33%)
CUB 471..580 CDD:278839
FXa_inhibition 591..623 CDD:291342
CUB 627..736 CDD:278839
FXa_inhibition 743..778 CDD:291342
CUB 783..892 CDD:278839
CUB 896..1009 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.