DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and ASTL

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_011509507.1 Gene:ASTL / 431705 HGNCID:31704 Length:436 Species:Homo sapiens


Alignment Length:222 Identity:87/222 - (39%)
Similarity:123/222 - (55%) Gaps:21/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFEGDIMLHREL-LRNGLLNERLTWPEAA-----VPFYIDPQDFNANQTMVILKAFKEYHDRTCI 140
            |.||||:..... |.:...|:   ||...     |||.:..: ::.....|||:|..|:...|||
Human    78 LIEGDIIRPSPFRLLSATSNK---WPMGGSGVVEVPFLLSSK-YDEPSRQVILEALAEFERSTCI 138

  Fly   141 RFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVT--HGVVVHELLHALGFYHQQS 203
            ||..| |..:.::.|...| ||:|||||..|.||::| .|.|:.  .|:|:|||:|.|||:|:.:
Human   139 RFVTY-QDQRDFISIIPMY-GCFSSVGRSGGMQVVSL-APTCLQKGRGIVLHELMHVLGFWHEHT 200

  Fly   204 ATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPL-DP 267
            ..:||.|:::||..||.|...||.|   :..:|....|||.|||||...|||:.|..||.|| .|
Human   201 RADRDRYIRVNWNEILPGFEINFIK---SQSSNMLTPYDYSSVMHYGRLAFSRRGLPTITPLWAP 262

  Fly   268 YASLGQRRGLSDKDVSKLNEMYEQDCS 294
            ...:|||..||..|::::.::|  .||
Human   263 SVHIGQRWNLSASDITRVLKLY--GCS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 80/199 (40%)
ZnMc_astacin_like 110..289 CDD:239807 75/181 (41%)
ASTLXP_011509507.1 Astacin 97..288 CDD:279708 81/203 (40%)
ZnMc 105..286 CDD:294052 76/189 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159324
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4437
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.