DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and CG5715

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster


Alignment Length:225 Identity:96/225 - (42%)
Similarity:136/225 - (60%) Gaps:14/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EHCGLF-EGDIML---HREL----LRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEY 134
            |..|.: ||||::   :|:.    .|||:|.....||...||:.| ...|.:.:...|..|||||
  Fly    70 EELGTYHEGDILIPLSYRDARFNGTRNGILALSSRWPGGVVPYEI-KGPFTSQELGNINHAFKEY 133

  Fly   135 HDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCV-THGVVVHELLHALGF 198
            |.:||:||:| ...:|.::.|....||||||:||..|.|.:||.:|.|: |:|..:|||:|||||
  Fly   134 HTKTCVRFKP-RTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGF 197

  Fly   199 YHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIE 263
            :|:|:..|||.||::..:||......||.|.:......|||||||.||||||..:|::||:.|::
  Fly   198 FHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLK 262

  Fly   264 PL---DPYASLGQRRGLSDKDVSKLNEMYE 290
            .|   ...:.:|||:|.|..||.|:|.||:
  Fly   263 ALRATSDASQMGQRKGFSAGDVRKINAMYK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 85/191 (45%)
ZnMc_astacin_like 110..289 CDD:239807 81/182 (45%)
CG5715NP_651242.1 Astacin 104..295 CDD:279708 85/191 (45%)
ZnMc_astacin_like 107..291 CDD:239807 81/185 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469481
Domainoid 1 1.000 146 1.000 Domainoid score I4542
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 145 1.000 Inparanoid score I4437
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 1 1.000 - - X245
1110.930

Return to query results.
Submit another query.