DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and MEP1B

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_005916.2 Gene:MEP1B / 4225 HGNCID:7020 Length:701 Species:Homo sapiens


Alignment Length:224 Identity:99/224 - (44%)
Similarity:131/224 - (58%) Gaps:14/224 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFEGDIMLHRELLRNGLLNERLTWPEAAVPFYI-DPQDFNANQTMVILKAFKEYHDRTCIRFRPY 145
            ||||||.|.|..:||.::.|:..||. .:|:.: |..:.||..  |||.||:.|..:|||.|:|:
Human    48 LFEGDIRLDRAQIRNSIIGEKYRWPH-TIPYVLEDSLEMNAKG--VILNAFERYRLKTCIDFKPW 109

  Fly   146 EQGDKHWLLIKGNYSGCWSSVG-RRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDE 209
            .....:..:.||  |||||||| ||.|.|.|::.. .|.....|.||.||||||:|:||.::||:
Human   110 AGETNYISVFKG--SGCWSSVGNRRVGKQELSIGA-NCDRIATVQHEFLHALGFWHEQSRSDRDD 171

  Fly   210 YVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATI--EPLDPYASLG 272
            ||:|.|:.||.|..||||.|:.....:..|.|||.||||||..||....:.||  ...|....:|
Human   172 YVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIG 236

  Fly   273 QRRGLSDKDVSKLNEMYEQDCSEDYLLNF 301
            ||...||.|:.|||::|  :||..  |:|
Human   237 QRMDFSDSDLLKLNQLY--NCSSS--LSF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 85/194 (44%)
ZnMc_astacin_like 110..289 CDD:239807 81/182 (45%)
MEP1BNP_005916.2 ZnMc_meprin 26..255 CDD:239809 95/214 (44%)
Astacin 69..257 CDD:279708 85/195 (44%)
MAM 260..427 CDD:214533 1/2 (50%)
MAM 265..427 CDD:99706
MATH 427..586 CDD:295307
Required for proteolytic processing 595..607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 146 1.000 Domainoid score I4542
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H48382
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8634
orthoMCL 1 0.900 - - OOG6_108702
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.