DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and CG6974

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_650414.1 Gene:CG6974 / 41815 FlyBaseID:FBgn0038285 Length:251 Species:Drosophila melanogaster


Alignment Length:211 Identity:71/211 - (33%)
Similarity:106/211 - (50%) Gaps:22/211 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYE---QGDKHWLLIK 156
            ||.|.:....||...:.:.|. .|::..:...:..|...:.::||::|...|   ...|.::..|
  Fly    47 RNALTSPLQRWPGNKILYRIS-TDYSEQEVANVRTAMSSFGEQTCVQFEEIEGAPPAGKRYVSFK 110

  Fly   157 GNYSGCWSSVGRRSGGQVLNLN------TPKCVT-HGVVVHELLHALGFYHQQSATERDEYVKIN 214
            .:.:.|    |.|.|.|.|:..      ..||:| ..|:.||.||.||.:|:||..:|||||:|:
  Fly   111 KSPNMC----GTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQSRPDRDEYVQID 171

  Fly   215 WENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKN-GKATIEPL----DPYASLGQR 274
            ::||...:...|  .|....|.|.|.|||:||||||..||:|: .|.||..|    .....:||.
  Fly   172 YDNIPRKYWSQF--MAMDQTTTFNVPYDYESVMHYSKNAFAKDPSKPTIRALIGGKAVEREMGQV 234

  Fly   275 RGLSDKDVSKLNEMYE 290
            ||.|:.|.:|:..||:
  Fly   235 RGPSEGDWTKIRLMYK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 68/202 (34%)
ZnMc_astacin_like 110..289 CDD:239807 64/193 (33%)
CG6974NP_650414.1 Astacin 55..251 CDD:279708 68/203 (33%)
ZnMc_astacin_like 59..249 CDD:239807 64/196 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D122071at6656
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.