DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and npsn

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_991319.2 Gene:npsn / 404039 ZFINID:ZDB-GENE-040420-2 Length:280 Species:Danio rerio


Alignment Length:238 Identity:87/238 - (36%)
Similarity:133/238 - (55%) Gaps:37/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EHCG--------LFEGDIMLHRELLRNGLLN-ERLT-----WPEAA-----VPFYIDPQDFNANQ 123
            :|.|        || |||...|     ||.| ::.|     |..:.     ||:.|. :.::..:
Zfish    53 KHAGENTDGPVILF-GDIAFPR-----GLQNADQCTARGCKWDRSRDGLVYVPYQIS-RAYSPRE 110

  Fly   124 TMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVV 188
            ..||.:..:.:...:||||.|: .|::::|.||.. |||:|.:||..||||::|....||....|
Zfish   111 VAVIEQGLQSFSAVSCIRFVPH-TGERNYLNIKSE-SGCYSYLGRIGGGQVVSLQRQGCVYFSTV 173

  Fly   189 VHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRA 253
            .|||||||||:|:|:.::||.:::|.::||:....:||||   .:..|.|..|||.|||.||..|
Zfish   174 QHELLHALGFHHEQNRSDRDNHIRILYQNIIPAQQYNFNK---QNTNNLGTPYDYNSVMQYSRYA 235

  Fly   254 FSKNGKATIEPLDPYAS--LGQRRGLSDKDVSKLNEMYEQDCS 294
            ||.|.:.|:.|: |.|:  ||:.:.:|..|:.::|.:|   ||
Zfish   236 FSMNNQPTMVPV-PNANVVLGEAQSMSPNDILRINRLY---CS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 76/203 (37%)
ZnMc_astacin_like 110..289 CDD:239807 71/180 (39%)
npsnNP_991319.2 Astacin 87..275 CDD:279708 75/198 (38%)
ZnMc_hatching_enzyme 93..273 CDD:239810 72/189 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.