DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-23

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001022281.1 Gene:nas-23 / 3565992 WormBaseID:WBGene00003542 Length:537 Species:Caenorhabditis elegans


Alignment Length:246 Identity:84/246 - (34%)
Similarity:128/246 - (52%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SDTNIWEHCGLFEGDIMLHRELLRNGLLNERL-------------TWPEAA----VPFYIDPQ-D 118
            ||.|..:...||:|||.|..|.|.| ::.|:|             .:|:..    |||.:... .
 Worm    74 SDLNRSKRDLLFQGDIHLSFEHLSN-IVREQLDHSRTKRTAFRNAMYPKTIWLPNVPFELHGSLS 137

  Fly   119 FNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGR--RSGGQVLNLNTPK 181
            ..:..::|...||.|.|  ||:.|:. ...:|.:||:.|...||||:|||  ..|.|:||:.| .
 Worm   138 AKSRSSLVAAMAFWEKH--TCVAFKK-RTSEKVYLLMSGQEEGCWSTVGRDEAQGAQILNIGT-G 198

  Fly   182 CVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSV 246
            |...|:..||:.||||.:|:||..:||.||:|....|...:.::|....:.::..:|.:||..||
 Worm   199 CEMFGITSHEIAHALGLFHEQSRYDRDNYVQIVKSRIAQTNFYDFAVVGKKNMETYGQKYDIGSV 263

  Fly   247 MHYSSRAFSKNGKATI--EPLDPYASLGQRRGLSDKDVSKLNEMY--EQDC 293
            |||....||.:|..:|  :.::...::||.||.|..||:|:|..|  |::|
 Worm   264 MHYRPTEFSLDGGNSIIAKDVNMQNTMGQFRGPSFIDVAKINRHYNCEKNC 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 70/201 (35%)
ZnMc_astacin_like 110..289 CDD:239807 66/183 (36%)
nas-23NP_001022281.1 Astacin 122..310 CDD:279708 67/191 (35%)
ZnMc_astacin_like 128..308 CDD:239807 66/183 (36%)
CUB 384..454 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.