DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and CG7631

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster


Alignment Length:235 Identity:95/235 - (40%)
Similarity:136/235 - (57%) Gaps:12/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PA-FNFWTEDSDTNIWEHCGLFEGDIMLHRELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMV 126
            || ||...:::|..:  ..|.|:||:.:  :..|||.|:|...||.|.||:.|. ::|:|.....
  Fly    20 PAPFNTHYDETDPEL--TAGYFQGDMDV--DYARNGQLSETRRWPNATVPYRIS-EEFDAPHVEY 79

  Fly   127 ILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPK----CVTHGV 187
            |....:.....:||||.|.::.::::|.:..:.|||.|.||.:.|.:.:.|....    |...|.
  Fly    80 IKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKLKPGSLDTGCFKLGT 144

  Fly   188 VVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSR 252
            :.|||||.|||:|||.:..|||:|||..|||.:||..||.||....:.:|...|||.|::||||.
  Fly   145 IQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFDQPYDYGSILHYSSL 209

  Fly   253 AFSKNGKATIEPLDP--YASLGQRRGLSDKDVSKLNEMYE 290
            |||.||:|||..|:|  ...:|||..:||.||.:||.||:
  Fly   210 AFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 81/193 (42%)
ZnMc_astacin_like 110..289 CDD:239807 76/184 (41%)
CG7631NP_609760.1 Astacin 57..251 CDD:279708 81/194 (42%)
ZnMc_astacin_like 61..248 CDD:239807 77/187 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469485
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.