DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Semp1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_609756.1 Gene:Semp1 / 34914 FlyBaseID:FBgn0028944 Length:251 Species:Drosophila melanogaster


Alignment Length:219 Identity:88/219 - (40%)
Similarity:123/219 - (56%) Gaps:12/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GLFEGDIMLHRELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPY 145
            |.::|||..|....|||::|:...||...||:.|:...|..:....||:|.....:.:|:.|:|.
  Fly    29 GFYQGDIKAHPIRTRNGIVNQIYHWPNRTVPYMIEDDAFADSHYREILRAISIIEENSCVIFKPA 93

  Fly   146 EQGDKHWLLI---KGNYSGCWS-SVGRRSGGQVLNLNT----PKCVTHGVVVHELLHALGFYHQQ 202
            .:.|....|:   ||  .||.: .:|.|:..||:||..    ..|...|.::|||||.|||.||.
  Fly    94 TEMDFPMALVITSKG--LGCNTVHLGYRNKTQVVNLEIYPLGEGCFRIGSIIHELLHVLGFEHQH 156

  Fly   203 SATERDEYVKINWENILDGHAHNF-NKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLD 266
            .:..||:||.|.|:||...:..|| |....|...:|...|||:|||||..||||:||:.||.||.
  Fly   157 VSQNRDQYVSIQWKNINPQYNINFVNNDNSTAWHDFDEGYDYESVMHYVPRAFSRNGQPTIVPLR 221

  Fly   267 PYA-SLGQRRGLSDKDVSKLNEMY 289
            ..| ::|||..:|:||:.|||:||
  Fly   222 EGAENMGQRFYMSEKDIRKLNKMY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 79/196 (40%)
ZnMc_astacin_like 110..289 CDD:239807 75/188 (40%)
Semp1NP_609756.1 Astacin 53..249 CDD:279708 79/195 (41%)
ZnMc_astacin_like 55..245 CDD:239807 75/191 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444821
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.