DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and CG15255

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001285958.1 Gene:CG15255 / 34913 FlyBaseID:FBgn0028950 Length:261 Species:Drosophila melanogaster


Alignment Length:224 Identity:92/224 - (41%)
Similarity:123/224 - (54%) Gaps:15/224 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GLFEGDIMLHRE----------LLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYH 135
            |..|||:||..|          ..||||:|....||...|.:.|. .||:......|........
  Fly    34 GFVEGDMMLTEEQQRNLEQGAPKARNGLINTEKRWPGNVVVYRIS-DDFDTAHKKAIQTGIDTLE 97

  Fly   136 DRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNT----PKCVTHGVVVHELLHAL 196
            ..||:|||.....||.:|.:.....||:::||.:...|.:||..    ..|...|.::||.:|||
  Fly    98 LHTCLRFREATDEDKAYLTVTAKSGGCYTAVGYQGAPQEMNLEIYPLGEGCFRPGTILHEFMHAL 162

  Fly   197 GFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKAT 261
            |||||||::.||:::.:.:|||:.|...||.|||.|.:|:|.|.|||.|.:||...|||.||:.|
  Fly   163 GFYHQQSSSIRDDFINVIYENIVPGKEFNFQKYADTVVTDFEVGYDYDSCLHYRPGAFSINGEDT 227

  Fly   262 IEPLDPYASLGQRRGLSDKDVSKLNEMYE 290
            |.|||..|.:|||.|||.||:.|:|.||:
  Fly   228 IVPLDSSAVIGQRVGLSSKDIDKINIMYK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 80/191 (42%)
ZnMc_astacin_like 110..289 CDD:239807 76/182 (42%)
CG15255NP_001285958.1 Astacin 66..258 CDD:279708 80/192 (42%)
ZnMc_astacin_like 70..255 CDD:239807 76/185 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444894
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm44135
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
98.860

Return to query results.
Submit another query.