DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Adgrg6

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_218313.7 Gene:Adgrg6 / 308376 RGDID:1308551 Length:1248 Species:Rattus norvegicus


Alignment Length:214 Identity:46/214 - (21%)
Similarity:69/214 - (32%) Gaps:66/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LHRELLRNGLLNERLT-------------WPEAAVPFYIDPQDFNANQTMVIL---KAFKEYHDR 137
            |..|:|||......||             |....:||......||:.|.:.|.   .|.||...:
  Rat  1057 LREEVLRNLRSVVSLTFLLGMTWGFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKENVQK 1121

  Fly   138 ------TCIRFRPYEQGDKHWL-----LIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVV--- 188
                  .|.|||..:..|  |.     :||.:......|:...|.|......|.|..:....   
  Rat  1122 QWRRHLCCGRFRLADNSD--WSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFK 1184

  Fly   189 -------------VHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVE 240
                         :.:|.||.|        |:...:.::  .::|    ....|...|..||   
  Rat  1185 RNSHSDSTSMDKSLSKLTHAGG--------EQTSIIPVH--QVID----KVKGYCNAHSDNF--- 1232

  Fly   241 YDYQSVMHYSSRAFSKNGK 259
              |::::  .|.|||.:.|
  Rat  1233 --YKNII--LSDAFSHSTK 1247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 40/199 (20%)
ZnMc_astacin_like 110..289 CDD:239807 38/180 (21%)
Adgrg6XP_218313.7 CUB 38..146 CDD:238001
LamG 178..337 CDD:304605
GPS 799..844 CDD:280071
7tm_4 861..1108 CDD:304433 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.