DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Astl

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001099974.1 Gene:Astl / 296129 RGDID:1562279 Length:436 Species:Rattus norvegicus


Alignment Length:240 Identity:88/240 - (36%)
Similarity:128/240 - (53%) Gaps:21/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PAFNFWTEDSDTNIWEHCGLFEGDIMLHRELLRNGLLNERLTWPEAA-----VPFYIDPQDFNAN 122
            ||.|......:|.  |...|.||||:.........:.|.:  ||:..     :||.:..: ::..
  Rat    56 PAINQGLISEETP--ESSFLVEGDIIRPSPFRLLSVTNNK--WPKGVDGIVEIPFLLSSK-YDEP 115

  Fly   123 QTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVT--H 185
            ...||::||.|:...|||||..| :|.:.::.|. ..:||:|.|||..|.||::| .|.|:.  .
  Rat   116 SRQVIMEAFAEFERFTCIRFVAY-RGQRDFVSIL-PMAGCFSGVGRSGGMQVVSL-APTCLQKGR 177

  Fly   186 GVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYS 250
            |:|:|||:|.|||:|:.|..:||.|:::||..||.|...||.|   :..:|....|||.|||||.
  Rat   178 GIVLHELMHVLGFWHEHSRADRDRYIRVNWNEILPGFEINFIK---SRNSNMLAPYDYSSVMHYG 239

  Fly   251 SRAFSKNGKATIEPL-DPYASLGQRRGLSDKDVSKLNEMYEQDCS 294
            ..|||..|:.||.|| .....:|||..||..|::::..:|  .||
  Rat   240 RFAFSWRGQPTIIPLWTSSVHIGQRWNLSTSDITRVCRLY--SCS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 77/199 (39%)
ZnMc_astacin_like 110..289 CDD:239807 72/181 (40%)
AstlNP_001099974.1 Astacin 92..283 CDD:279708 77/202 (38%)
ZnMc 99..281 CDD:294052 73/190 (38%)
ImpA_N <305..420 CDD:303075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353351
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 150 1.000 Inparanoid score I4289
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.