DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Mep1b

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_037315.1 Gene:Mep1b / 25727 RGDID:3081 Length:704 Species:Rattus norvegicus


Alignment Length:253 Identity:100/253 - (39%)
Similarity:138/253 - (54%) Gaps:20/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PAFNFWTEDSD-------TNIWEHCG--LFEGDIMLHRELLRNGLLNERLTWPEAAVPFYI-DPQ 117
            ||...:.:|.|       .:|.|..|  ||||||.|... .||.::.:...||. .:|:.: |..
  Rat    22 PAPEKFVKDIDGGIDQDIFDINEDLGLDLFEGDIKLEAS-GRNSIIGDNYRWPH-TIPYVLEDSL 84

  Fly   118 DFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGR-RSGGQVLNLNTPK 181
            :.||..  |||.||:.|..:|||.|:|:...:.:..:.||  ||||||||. .:|.|.|::.| .
  Rat    85 EMNAKG--VILNAFERYRLKTCIDFKPWSGEENYISVFKG--SGCWSSVGNIHAGKQELSIGT-N 144

  Fly   182 CVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSV 246
            |.....|.||.||||||:|:||..:||:|:.|.|:.||.|..||||.|..:...:..|.|||.||
  Rat   145 CDRIATVQHEFLHALGFWHEQSRADRDDYITIVWDRILSGKEHNFNIYNDSVSDSLNVPYDYTSV 209

  Fly   247 MHYSSRAFSKNGKATI--EPLDPYASLGQRRGLSDKDVSKLNEMYEQDCSEDYLLNFD 302
            ||||..||....::||  :..|....:|||...||.|:.|||::|....|..::.:.|
  Rat   210 MHYSKTAFQNGTESTIITKISDFEDVIGQRMDFSDYDLLKLNQLYSCTSSLSFMDSCD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 82/194 (42%)
ZnMc_astacin_like 110..289 CDD:239807 79/182 (43%)
Mep1bNP_037315.1 ZnMc 30..256 CDD:294052 96/232 (41%)
Astacin 70..258 CDD:279708 82/193 (42%)
MAM 266..430 CDD:279023 1/2 (50%)
MAM 266..428 CDD:99706 1/2 (50%)
MATH 428..586 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4301
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H48382
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46196
orthoMCL 1 0.900 - - OOG6_108702
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.