DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Tll1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_033416.2 Gene:Tll1 / 21892 MGIID:106923 Length:1013 Species:Mus musculus


Alignment Length:211 Identity:67/211 - (31%)
Similarity:106/211 - (50%) Gaps:29/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKH-WLLIKGNYSGCWS 164
            ||: ||...:| |:...:|..:|..:..:|.:.:...||:.|.  |:.|:. :::......||.|
Mouse   154 ERI-WPGGVIP-YVIGGNFTGSQRAMFKQAMRHWEKHTCVTFT--ERSDEESYIVFTYRPCGCCS 214

  Fly   165 SVGRRSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNK 228
            .||||..| |.:::. ..|...|:|||||.|.:||:|:.:..:||.:|.|..|||..|..:||.|
Mouse   215 YVGRRGNGPQAISIG-KNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLK 278

  Fly   229 YARTHITNFGVEYDYQSVMHYSSRAFSK-------------NGKATIEPLDPYASLGQRRGLSDK 280
            .....:.:.|..||:.|:|||:...||:             ||   |.|     ::|||..||..
Mouse   279 MEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNG---IRP-----AIGQRTRLSKG 335

  Fly   281 DVSKLNEMYE-QDCSE 295
            |:::..::|. ..|.|
Mouse   336 DIAQARKLYRCPACGE 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 64/206 (31%)
ZnMc_astacin_like 110..289 CDD:239807 60/193 (31%)
Tll1NP_033416.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..150
ZnMc_BMP1_TLD 148..347 CDD:239808 65/205 (32%)
Astacin 155..348 CDD:279708 64/205 (31%)
CUB 349..458 CDD:278839 2/3 (67%)
CUB 462..571 CDD:278839
FXa_inhibition 582..614 CDD:291342
CUB 618..727 CDD:278839
FXa_inhibition 734..769 CDD:291342
CUB 774..883 CDD:278839
CUB 887..1000 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.