DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Astl

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001277932.1 Gene:Astl / 215095 MGIID:3046414 Length:435 Species:Mus musculus


Alignment Length:294 Identity:98/294 - (33%)
Similarity:146/294 - (49%) Gaps:28/294 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PGLICFWSALALALSATLEASTPATRKALLRARPAVPPAARWGANMQMLRRHNSPAFNFWTEDSD 73
            |.::...|.|.|::.|      |:..:.......:||.... .....:.:..:.||.|......:
Mouse     9 PWILTMLSLLGLSMGA------PSASRCSGVCSTSVPEGFT-PEGSPVFQDKDIPAINQGLISEE 66

  Fly    74 TNIWEHCGLFEGDIMLHRELLRNGLLNERLTWPEAA-----VPFYIDPQDFNANQTMVILKAFKE 133
            |.  |...|.||||:.........:.|.:  ||:..     :||.:. :.::.....||:.||.|
Mouse    67 TP--ESSFLVEGDIIRPSPFRLLSVTNNK--WPKGVGGFVEIPFLLS-RKYDELSRRVIMDAFAE 126

  Fly   134 YHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVT--HGVVVHELLHAL 196
            :...|||||..| .|.:.::.|. ..:||:|.|||..|.||::| .|.|:.  .|:|:|||:|.|
Mouse   127 FERFTCIRFVAY-HGQRDFVSIL-PMAGCFSGVGRSGGMQVVSL-APTCLRKGRGIVLHELMHVL 188

  Fly   197 GFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKAT 261
            ||:|:.|..:||.|:::||..||.|...||.|   :..||..|.|||.|||||...|||..|:.|
Mouse   189 GFWHEHSRADRDRYIQVNWNEILPGFEINFIK---SRSTNMLVPYDYSSVMHYGRFAFSWRGQPT 250

  Fly   262 IEPL-DPYASLGQRRGLSDKDVSKLNEMYEQDCS 294
            |.|| .....:|||..||..|::::..:|  :||
Mouse   251 IIPLWTSSVHIGQRWNLSTSDITRVCRLY--NCS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 79/199 (40%)
ZnMc_astacin_like 110..289 CDD:239807 74/181 (41%)
AstlNP_001277932.1 Astacin 92..282 CDD:279708 77/200 (39%)
ZnMc 100..281 CDD:294052 75/189 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849692
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4329
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm44135
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.