DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Y19D10A.6

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_503652.3 Gene:Y19D10A.6 / 189484 WormBaseID:WBGene00021221 Length:272 Species:Caenorhabditis elegans


Alignment Length:203 Identity:64/203 - (31%)
Similarity:93/203 - (45%) Gaps:42/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 WPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKG--NYSGCWSSVG 167
            ||.|.||:.| ...:.:.:..:||.|.:.:.:.||:||||....|||:|.|..  |...|:|.:|
 Worm    60 WPNAEVPYDI-ATHYTSTEKSIILSAMEAFKNVTCVRFRPRAATDKHYLQINKYFNVERCFSYIG 123

  Fly   168 RRSGGQVL-----NLNT-----PKCVT---HGVVVHELLHALGFYHQQSATERDEYVKINWENIL 219
            |:|...:.     |:.|     |.|:.   .|:|:|||:|.|||||:....:||       ..|:
 Worm   124 RQSSRTLFGTPEGNVETRMRLDPACLRGNGRGIVMHELMHILGFYHEHQRDDRD-------RRIV 181

  Fly   220 DGHAH-NFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDPYASLGQRRG-LSDKDV 282
            ....| ||..|.|......|. ||..|:|||:.:..            |:    |||. .|..|:
 Worm   182 GSAVHYNFKIYRRAKTLYMGA-YDANSIMHYNFQNL------------PW----QRRDHFSTSDI 229

  Fly   283 SKLNEMYE 290
            ..:|..|:
 Worm   230 ININTFYK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 64/203 (32%)
ZnMc_astacin_like 110..289 CDD:239807 60/195 (31%)
Y19D10A.6NP_503652.3 Astacin 58..240 CDD:279708 64/203 (32%)
ZnMc 62..236 CDD:294052 61/198 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.