DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-27

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_493926.2 Gene:nas-27 / 188809 WormBaseID:WBGene00003545 Length:428 Species:Caenorhabditis elegans


Alignment Length:270 Identity:73/270 - (27%)
Similarity:131/270 - (48%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LLRARPAVPPAARWGANMQMLRRHNSPAFNFWTEDSDTNIWEHCG--LFEGDIMLHRELLRNGLL 99
            |:.:..|:|...|      .:|..|         :.|.|.....|  |::|||.:.:...|..::
 Worm    11 LITSLHAIPRGRR------AVRNRN---------EGDINSLVGVGQYLYQGDIAVVKSRARRAVI 60

  Fly   100 NERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWS 164
            .::....:..:|:..| ::|.:.....:|:|.:.:.::||:.|........|..:.:||  ||||
 Worm    61 RQKHKKWKLPMPYSFD-RNFPSRSRQRVLEAMQFWSEKTCVTFHENRYVYPHVSIFEGN--GCWS 122

  Fly   165 SVGRRSGGQVLNLNTPK-CVTHG-VVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFN 227
            .||::...:..:|:..: |..|. ||.||:.|.|||||:.:..:||:::.|::.|:.......|.
 Worm   123 FVGKQPSLREQSLSLERSCTDHTFVVAHEIAHTLGFYHEHARGDRDQFISIDYSNVNPNLTFAFA 187

  Fly   228 KYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDPYA-------SLGQRRGLSDKDVSKL 285
            |.:...:.:....|:|.||||||...|:.|   |..|: .||       ::|.|...:.:|||::
 Worm   188 KESEKQLDHQEAAYEYGSVMHYSVDQFAVN---TNRPV-IYARDQKFAQAMGNRMRATFQDVSRM 248

  Fly   286 NEMYEQDCSE 295
            |.:|  :|.|
 Worm   249 NVLY--NCHE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 58/199 (29%)
ZnMc_astacin_like 110..289 CDD:239807 56/187 (30%)
nas-27NP_493926.2 Astacin 65..254 CDD:279708 57/197 (29%)
ZnMc_astacin_like 70..252 CDD:239807 56/188 (30%)
CUB 334..410 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.