DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-22

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_505908.2 Gene:nas-22 / 188423 WormBaseID:WBGene00003541 Length:367 Species:Caenorhabditis elegans


Alignment Length:216 Identity:55/216 - (25%)
Similarity:97/216 - (44%) Gaps:20/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 HRE--LLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRF--RPYEQGDK 150
            ||.  |:|......|..|....|.:|...::|:......||:|.:...:.|||:|  .|.|:..:
 Worm    37 HRRQVLIRGSDEERRHKWFNNTVHYYFYEENFDFTVKESILRAMELISNHTCIKFSTEPSEKSIR 101

  Fly   151 HWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYV--KI 213
              :........|::.:|:....|:.:.|: .|.:.||.||||:|:|||.|....::||:|:  |.
 Worm   102 --MESDSTTIACYAEIGQVRENQLFSFNS-DCYSAGVAVHELIHSLGFIHAHQRSDRDQYLEFKK 163

  Fly   214 NWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDPYASLGQRRG-- 276
            |.:.:...:...:..:....|.   |.||..|||.|.:....:     ..|:..|.::....|  
 Worm   164 NLDELNQTYQEQYKIWEYQEIL---VPYDVGSVMQYPNEEDEE-----YYPVRKYRTMANTMGSA 220

  Fly   277 -LSDKDVSKLNEMYEQDCSED 296
             ::..|...:|:.||..|:.:
 Worm   221 IVAFYDYLMINKYYECSCANN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 50/197 (25%)
ZnMc_astacin_like 110..289 CDD:239807 46/185 (25%)
nas-22NP_505908.2 ZnMc 50..192 CDD:214576 39/147 (27%)
ZnMc 56..234 CDD:294052 46/188 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.