DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-33

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_509086.2 Gene:nas-33 / 186987 WormBaseID:WBGene00003551 Length:644 Species:Caenorhabditis elegans


Alignment Length:226 Identity:78/226 - (34%)
Similarity:119/226 - (52%) Gaps:22/226 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFEGDIML----HRELLRNGLLNER------LTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHD 136
            :||.|:.|    ..::.:||...:|      .|| ...:|:..  .|.:.|....|....:.|..
 Worm   169 MFESDMALTVSQMNKVAQNGFRVKRKMNLNGTTW-SRNIPYRF--LDTDGNWQSQITNGLRHYER 230

  Fly   137 RTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQ 201
            .|||||.....|..:.:..||  .||:|||||..|.|.:::. ..|.|.|::.||:.|||||:|:
 Worm   231 NTCIRFSLNGGGSDYLVFSKG--EGCYSSVGRLGGPQEISIG-DGCETLGIITHEVGHALGFWHE 292

  Fly   202 QSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKA-TIEPL 265
            |:..|||.||:||.:|.::|....|:|.:.:.:..:.:.|||.|||||..::|||:... |:||:
 Worm   293 QARPERDSYVRINRQNAINGLEGQFDKRSWSEVNEYSLPYDYGSVMHYGPKSFSKSSTMNTVEPV 357

  Fly   266 DP--YASLGQRRGLSDKDVSKLNEMYEQDCS 294
            ||  ..::|.|...|..|:..||..:   ||
 Worm   358 DPAFINTIGNRVEPSFLDLKLLNTAF---CS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 71/194 (37%)
ZnMc_astacin_like 110..289 CDD:239807 67/181 (37%)
nas-33NP_509086.2 Astacin 200..386 CDD:279708 71/195 (36%)
ZnMc_astacin_like 203..381 CDD:239807 66/182 (36%)
CUB 442..527 CDD:294042
TSP1 553..595 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.