DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-31

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001023994.1 Gene:nas-31 / 186493 WormBaseID:WBGene00003549 Length:611 Species:Caenorhabditis elegans


Alignment Length:333 Identity:95/333 - (28%)
Similarity:140/333 - (42%) Gaps:81/333 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ATLEASTPATRKALLRARPAVPPAAR-WGANMQMLRRHNSPAFNFWTEDSDTN------------ 75
            |.||.:.|.|.  |.|.|.|:....: |.|.:|.:     ||.|:  :::.||            
 Worm    43 AELEKTFPRTN--LSRMRNALKSLRQNWSAKLQAM-----PARNY--QNAGTNQENGATEQQKPL 98

  Fly    76 -----------------IWEHCG----LFEGDIMLHRELL------------------RNGLLNE 101
                             :.:..|    |::||::|..:.:                  |.....:
 Worm    99 REKPRDRVKMEGDTLHQVNKAAGLNDILYQGDMVLTDDQIATILEARDETTVSTASRARRQAYRD 163

  Fly   102 R----LTWPEAAVPFYIDPQDFNANQTMVILKAFKE----YHDRTCIRFRPYEQGDKHWLLIKGN 158
            |    .|| .::|.:|.|     ...|..|:|||::    :.:.|||.............:.|| 
 Worm   164 RYYPSTTW-GSSVYYYYD-----RTATPKIVKAFEQAVAFWQNVTCINIMQSSTAINRIRVFKG- 221

  Fly   159 YSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHA 223
             .||:|.|||.||.|.|:|.| .|...|...|||.|||||:|.||..:||.|:.||:.||...:.
 Worm   222 -QGCYSYVGRISGVQDLSLGT-GCEEFGTAAHELGHALGFFHTQSRYDRDNYISINYANIDPSYV 284

  Fly   224 HNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLD-PYASLGQRRGLSDKDVSKLNE 287
            ..|:|.......|:|:.|||.|:|.|.:.:.|.|.|||:...| .|........:...|:|.:||
 Worm   285 EQFDKETSNTNFNYGMPYDYGSIMQYGATSASSNDKATMIARDTEYQDTMGSDFVGFYDISMMNE 349

  Fly   288 MYEQDCSE 295
            .|:  |.|
 Worm   350 HYK--CKE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 70/195 (36%)
ZnMc_astacin_like 110..289 CDD:239807 66/183 (36%)
nas-31NP_001023994.1 Astacin 169..355 CDD:279708 70/196 (36%)
ZnMc_astacin_like 175..351 CDD:239807 66/183 (36%)
ShKT 532..564 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.