Sequence 1: | NP_573318.1 | Gene: | CG6696 / 32856 | FlyBaseID: | FBgn0030947 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494953.3 | Gene: | nas-29 / 186488 | WormBaseID: | WBGene00003547 | Length: | 532 | Species: | Caenorhabditis elegans |
Alignment Length: | 257 | Identity: | 83/257 - (32%) |
---|---|---|---|
Similarity: | 119/257 - (46%) | Gaps: | 52/257 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 LFEGDIML--------------HRELLR--------NGLLNERLTWPEAAVPFYID---PQD--- 118
Fly 119 ------FNANQTMV----ILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGR--RSG 171
Fly 172 GQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITN 236
Fly 237 FGVEYDYQSVMHYSSRAFSK-NGKATIEPLDP--YASLGQRRGLSDKDVSKLNEMYEQDCSE 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6696 | NP_573318.1 | Astacin | 104..295 | CDD:279708 | 73/211 (35%) |
ZnMc_astacin_like | 110..289 | CDD:239807 | 69/199 (35%) | ||
nas-29 | NP_494953.3 | Astacin | 145..336 | CDD:279708 | 68/194 (35%) |
ZnMc_astacin_like | 148..332 | CDD:239807 | 66/185 (36%) | ||
CUB | 404..491 | CDD:214483 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D681837at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.920 |