DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-29

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_494953.3 Gene:nas-29 / 186488 WormBaseID:WBGene00003547 Length:532 Species:Caenorhabditis elegans


Alignment Length:257 Identity:83/257 - (32%)
Similarity:119/257 - (46%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFEGDIML--------------HRELLR--------NGLLNERLTWPEAAVPFYID---PQD--- 118
            |||||:.:              :|:.::        ||...:| |..:|    |:|   |..   
 Worm    89 LFEGDMAISYKQLSMIVNGSTEYRKAIKSRRRGNKINGESTDR-TKRQA----YLDNNYPATIWK 148

  Fly   119 ------FNANQTMV----ILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGR--RSG 171
                  |:.:.|.:    ||||...::..|||.|.| ....|.:||..||..||||:|||  ..|
 Worm   149 NGVAFMFHESLTPIAKTAILKAVHFWYRETCIEFHP-RTFQKEYLLFIGNDDGCWSTVGRDASQG 212

  Fly   172 GQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITN 236
            .||:::.. .|...||..|||.||||.:|:||..:|||.|..|...:......||.|.:...::.
 Worm   213 KQVVSIGN-GCEHFGVTSHELAHALGIFHEQSRFDRDESVVFNPRVVERDLLFNFAKISPRQMST 276

  Fly   237 FGVEYDYQSVMHYSSRAFSK-NGKATIEPLDP--YASLGQRRGLSDKDVSKLNEMYEQDCSE 295
            :|:.||..|||||:...||. ....|:..:|.  ..::||..|.|..||..:|:.|:  |.|
 Worm   277 YGLPYDIGSVMHYTPTEFSNIPSIPTLAAIDTNLQQTMGQLEGPSFVDVHIMNQHYQ--CQE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 73/211 (35%)
ZnMc_astacin_like 110..289 CDD:239807 69/199 (35%)
nas-29NP_494953.3 Astacin 145..336 CDD:279708 68/194 (35%)
ZnMc_astacin_like 148..332 CDD:239807 66/185 (36%)
CUB 404..491 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.