DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-24

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_506409.2 Gene:nas-24 / 184744 WormBaseID:WBGene00003543 Length:396 Species:Caenorhabditis elegans


Alignment Length:242 Identity:68/242 - (28%)
Similarity:106/242 - (43%) Gaps:50/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 WEHCGLF---EGDI-------MLHRELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAF 131
            :.:|||.   |.||       .:.||..|.|     ..|....:.:|.  .|.|.:....:..|.
 Worm    17 YAYCGLSRFNEHDIEGGDSYKRVKREFERLG-----SKWLGGTINYYY--ADNNNSVKEKVKSAI 74

  Fly   132 KEYHDRTCIRFRPYEQGDKHWLLIK---GNYSGCWSSV---GRRSG--GQVLNLNTPKCVTHGVV 188
            ....:.|||:|   .:...||..:|   ...|.|.|::   |.|||  |: |::.|..|...|.:
 Worm    75 AYIANHTCIKF---NEDPTHWQRLKIFTSELSHCRSTIGAPGTRSGSAGE-LSMETGWCANIGSI 135

  Fly   189 VHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTH----ITNFGVEYDYQSVMHY 249
            |||..|:||.||:.:..:||..:|:.          :.:..||..    .|.:| .:::.|:|.|
 Worm   136 VHEFSHSLGRYHEHTRPDRDNSLKVT----------STDYEARPRPWGMTTMYG-PFEHGSIMMY 189

  Fly   250 SSRAFSKNGKATIEPLD-PYA-SLGQRRGLSDKDVSKLNEMYEQDCS 294
            .|   |..|...:||.| .|. ::|.|| ::..|:.|:|:.|...||
 Worm   190 HS---SNYGVGKMEPYDMEYKNTMGSRR-VTFYDMYKINQYYGCGCS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 58/205 (28%)
ZnMc_astacin_like 110..289 CDD:239807 54/192 (28%)
nas-24NP_506409.2 Astacin 49..231 CDD:279708 56/202 (28%)
ZnMc 52..227 CDD:294052 54/195 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.