DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-14

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_502533.2 Gene:nas-14 / 184247 WormBaseID:WBGene00003533 Length:503 Species:Caenorhabditis elegans


Alignment Length:254 Identity:99/254 - (38%)
Similarity:142/254 - (55%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DSDTNIWEHCGLFEGDIMLHRELLRNGLLNERL----------------------------TWPE 107
            |::....::..|||||||...|:.::.:| :||                            .|||
 Worm    64 DAEIESMQNSLLFEGDIMGVPEIEKSDIL-KRLRDDPLLDEDEIFRKPFHSALNLVTYPDKLWPE 127

  Fly   108 AAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYS-GCWSSVGRRSG 171
            ..||:.:: :....:|...|.:||.||..:||:||.|....|..::.:|.|.: ||.|.|||..|
 Worm   128 GQVPYMLE-EGMTNDQRTAIAQAFDEYKTKTCVRFVPKTDDDFDYIYVKRNVAFGCSSYVGRAGG 191

  Fly   172 GQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITN 236
            .|.::|...||.:.|::.|||:|||||:|:.|.|:||::|.||.:||..|...||.||.|..|.:
 Worm   192 NQTVSLEVDKCFSKGIIAHELMHALGFFHEHSRTDRDDFVDINEDNIRPGMMRNFEKYPRKIIDS 256

  Fly   237 FGVEYDYQSVMHYSSRAFSKNGKATIEPLDPYASLGQRRGLSDKDVSKLNEMYEQDCSE 295
            .|:.|||:|||||...|||:|||.||.|.|..|.:|||..||:.|..|:|::|:  |.|
 Worm   257 LGMPYDYESVMHYHKLAFSRNGKPTIIPKDNEADVGQRYKLSEMDSKKVNKLYQ--CGE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 86/191 (45%)
ZnMc_astacin_like 110..289 CDD:239807 81/179 (45%)
nas-14NP_502533.2 Astacin 123..313 CDD:279708 86/192 (45%)
ZnMc_astacin_like 128..309 CDD:239807 81/181 (45%)
ShKT 380..414 CDD:214586
ShK 468..503 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166938
Domainoid 1 1.000 176 1.000 Domainoid score I2159
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm4830
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.