DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-12

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_501871.2 Gene:nas-12 / 182848 WormBaseID:WBGene00003531 Length:384 Species:Caenorhabditis elegans


Alignment Length:268 Identity:70/268 - (26%)
Similarity:125/268 - (46%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EASTPATRKALLRARPAVPPAARWGANMQMLRRHNSPAFNFWTEDSDTNIWEHCGLFEGDIMLHR 91
            |..|.|.::..:.....:.||       |::|..||       :|||.:|              |
 Worm    35 ELITEANKEHTVFGDMLLTPA-------QLIRYENS-------KDSDLSI--------------R 71

  Fly    92 ELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIK 156
            .:...|....|  |....||:.|.|| ::..|..:::.:.:.:...:|.:|  .|:..::..|..
 Worm    72 GVSIKGSSMNR--WSNNIVPYVISPQ-YSPAQKQILVSSLRYFERVSCFKF--VERTTQNDYLFI 131

  Fly   157 GNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDG 221
            ....||:|.||:..|.|.|:| ...|:...::.||::||:||.|:....:||.::::::.|::.|
 Worm   132 VPLDGCYSYVGKIGGRQTLSL-AADCIADYIIWHEMMHAIGFEHEHQRPDRDSFIRVDYANVIPG 195

  Fly   222 HAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGK------ATIEPLDPYASLGQRRGLSDK 280
            ...||:|...:|: .:...||::|:|||...||.:...      ||:.||.|..:|......:..
 Worm   196 QMINFDKLKTSHV-EYPDIYDFKSIMHYDGYAFGRVDTARRVRLATMTPLKPGVTLEDNMKFTAT 259

  Fly   281 DVSKLNEM 288
            |:.|||.:
 Worm   260 DIEKLNRL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 54/191 (28%)
ZnMc_astacin_like 110..289 CDD:239807 53/185 (29%)
nas-12NP_501871.2 Astacin 81..272 CDD:279708 55/194 (28%)
ZnMc_astacin_like 85..267 CDD:239807 53/186 (28%)
ShK 286..325 CDD:279838
ShK 347..384 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.