DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-7

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_495552.2 Gene:nas-7 / 182368 WormBaseID:WBGene00003526 Length:382 Species:Caenorhabditis elegans


Alignment Length:207 Identity:85/207 - (41%)
Similarity:127/207 - (61%) Gaps:3/207 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 FEGDIMLHRELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQ 147
            |:.||.|.|...|||:......||.|.:|:.|.|. ::.::..::.||.|:||::|||||.|.:.
 Worm    67 FKSDIRLPRRHKRNGVSRAAKLWPNARIPYAISPH-YSPHERALLAKAVKQYHEKTCIRFVPRQT 130

  Fly   148 GDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVK 212
            |:..:|.| |...||:|.|||.||.|||:|:. .|:.:..::||::|.:||||:....:||.::.
 Worm   131 GEPDYLFI-GKVDGCFSEVGRTSGVQVLSLDN-GCMEYATIIHEMMHVVGFYHEHERWDRDNFID 193

  Fly   213 INWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDPYASLGQRRGL 277
            |.|:||..|....|.|...:..:.:|..|||:|::||.|.||||||..|:.|....|::|..|..
 Worm   194 IIWQNIDRGALDQFGKVDLSKTSYYGQPYDYKSILHYDSLAFSKNGFPTMLPKVKSATIGNARDF 258

  Fly   278 SDKDVSKLNEMY 289
            ||.|:||:|.||
 Worm   259 SDVDISKINRMY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 77/186 (41%)
ZnMc_astacin_like 110..289 CDD:239807 72/178 (40%)
nas-7NP_495552.2 Astacin 87..274 CDD:279708 77/187 (41%)
ZnMc_astacin_like 91..270 CDD:239807 73/181 (40%)
ShK 347..382 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I2703
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm4854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.