DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-6

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001040902.1 Gene:nas-6 / 181796 WormBaseID:WBGene00003525 Length:344 Species:Caenorhabditis elegans


Alignment Length:224 Identity:85/224 - (37%)
Similarity:131/224 - (58%) Gaps:15/224 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 WEHCGLFEGDI---------MLHRELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFK 132
            |::.|.|:|||         :....:|.|.|.|::|||....:|:.:|.. |:.|:..::.|||.
 Worm    44 WQNSGKFQGDIDGVDPNLLKLPEGPVLFNALKNKQLTWEGGVIPYEMDTA-FSPNEIKILEKAFD 107

  Fly   133 EYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALG 197
            .|...|||||...|....:..::||  .||:|.|||..|.|.::|.. .|..|.::||||:|::|
 Worm   108 SYRRTTCIRFEKREGQTDYLNIVKG--YGCYSQVGRTGGKQEISLGR-GCFFHEIIVHELMHSVG 169

  Fly   198 FYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATI 262
            |:|:.|..:||:::||||:|||.|....|:|.:.......|..|||:|:|||.|.|||:||:.||
 Worm   170 FWHEHSRADRDDHIKINWDNILPGMKSQFDKISAVLQDLQGENYDYKSIMHYDSTAFSRNGRNTI 234

  Fly   263 EPLDPYAS--LGQRRGLSDKDVSKLNEMY 289
            |.::...:  :|....||..|:.|:|::|
 Worm   235 ETVENGFTQVIGTAMDLSPLDIVKINKLY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 74/188 (39%)
ZnMc_astacin_like 110..289 CDD:239807 71/180 (39%)
nas-6NP_001040902.1 Astacin 80..265 CDD:279708 74/188 (39%)
ZnMc_astacin_like 83..263 CDD:239807 71/183 (39%)
ShK 299..334 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.