DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and hch-1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_510440.1 Gene:hch-1 / 181564 WormBaseID:WBGene00001828 Length:605 Species:Caenorhabditis elegans


Alignment Length:273 Identity:89/273 - (32%)
Similarity:126/273 - (46%) Gaps:70/273 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFEGDIMLHRE----LLRN--------------------------GLLNERLTWPEAAVPFYIDP 116
            |||||::|..|    :::|                          ..|:||.::|   ||:|||.
 Worm    83 LFEGDMVLTDEQMDLIIKNVRDQYWARKSSTNEFLYAIRGKRSMTSFLSERWSFP---VPYYIDT 144

  Fly   117 QDFNANQTMVILKAFKEYHDRTCIRF---RPYEQGDKHWLL--IKGNYSGCWSSVGRRSGGQVLN 176
            .  :...|..:|....::...||.||   ..|....:...|  |.||  ||:|::|:.|      
 Worm   145 S--SGVNTNAVLAGVAKWEQETCARFTRLNSYSSSSRQNALRFISGN--GCYSNIGKVS------ 199

  Fly   177 LNTPK-------CVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHI 234
             ..|:       |.:.|.|.||:.|||||||:|:..:||:||.|..:||.|.:...|.|.:.:.:
 Worm   200 -RFPQDVSIGWGCTSLGTVCHEIGHALGFYHEQARYDRDDYVSILTQNIQDMYLSQFTKQSASSM 263

  Fly   235 TNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDP--YASLGQRRGLSDKDVSKLNEMY-EQDCSED 296
            .::||.|||.|||||...|||..|..||...||  .|::|||...|..||.::|..| ...||  
 Worm   264 VDYGVGYDYGSVMHYDQAAFSSTGGNTIATRDPNFQATIGQRVAPSFADVKRINFAYCNSTCS-- 326

  Fly   297 YLLNFDRFGNYID 309
                     ||:|
 Worm   327 ---------NYLD 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 74/205 (36%)
ZnMc_astacin_like 110..289 CDD:239807 71/192 (37%)
hch-1NP_510440.1 Astacin 132..323 CDD:279708 75/204 (37%)
ZnMc_astacin_like 135..320 CDD:239807 72/198 (36%)
CUB 386..466 CDD:214483
TSP1 533..565 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.