DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-10

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001257126.1 Gene:nas-10 / 181287 WormBaseID:WBGene00003529 Length:540 Species:Caenorhabditis elegans


Alignment Length:256 Identity:77/256 - (30%)
Similarity:114/256 - (44%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EHCGLFEGDIMLHRELLRNGLLNE------------------RLT----------WPEAA-VPFY 113
            |..|:|:.|::| .|...|.:|||                  |.:          ||..: :|:.
 Worm   251 EDNGVFDKDLLL-TETQANFMLNELGKGGEGAIPMPGSAKAKRASIFFEQNLIQKWPSTSPIPYT 314

  Fly   114 IDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNY---------SGC-WSSVGR 168
            .|....|.:|..| ..|..|...:|||||:.:....      |||:         |.| .|.:||
 Worm   315 FDSSLDNLDQNDV-RGAISEIEQKTCIRFKYFASPP------KGNHINYQKVNSPSFCGLSYIGR 372

  Fly   169 RSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTH 233
            ......:.|:.......|:.|||.:||||..||....:||:::|::|.||.......|.......
 Worm   373 VEPANPVYLSFQCGNGRGIAVHETMHALGVNHQHLRMDRDKHIKVDWSNINPQQYDAFVVADSKL 437

  Fly   234 ITNFGVEYDYQSVMHYSSRAFSKN-GKATIEPL-DPYAS---LGQRRGLSDKDVSKLNEMY 289
            .|.:||:|.|.|:|||::...:.| .|.|:.|| :..|:   ||||..:|:.||..||:||
 Worm   438 YTTYGVKYAYDSIMHYNAYTGAVNIAKPTMIPLVNQQANIGLLGQRAKMSNADVEILNKMY 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 66/212 (31%)
ZnMc_astacin_like 110..289 CDD:239807 62/193 (32%)
nas-10NP_001257126.1 Astacin 303..501 CDD:396122 66/203 (33%)
ShK 503..540 CDD:396228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.