DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-11

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001024789.1 Gene:nas-11 / 180938 WormBaseID:WBGene00003530 Length:579 Species:Caenorhabditis elegans


Alignment Length:244 Identity:67/244 - (27%)
Similarity:106/244 - (43%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EDSDTNIWEHCGLFEGDIMLHRELL--RNGLLNERLTW-PEAAVPFYIDP--QDFNANQTMVILK 129
            ||.|.:.....|...|...|.:..|  ...|:.:   | |.:.:.:.:|.  :|.:.|.   :..
 Worm   307 EDDDDSTNSASGAAPGSSRLKKSALYFEGNLIKK---WDPSSPIRYVLDSSLEDLDKND---VRA 365

  Fly   130 AFKEYHDRTCIRFR-----PYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVV 189
            |..|....|||||:     |......::.:....:.|. |.|||......:.|:.......||.:
 Worm   366 AIYEIEKNTCIRFKELSSPPTGSHIVYYKVDSPTFCGL-SYVGRADPANPVYLSFGCDNNKGVAI 429

  Fly   190 HELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAF 254
            ||.:||||..||....:||:::.|||.||.......|........|::||:|.|.|:|||:....
 Worm   430 HETMHALGVAHQHLRNDRDQFITINWSNIDPQQYDAFVVVDSKLYTSYGVKYAYDSIMHYNGYTA 494

  Fly   255 SKNGKATIEPLDPYAS-------LGQRRGLSDKDVSKLNEMYEQDCSED 296
            ::|  ..|..::|..:       ||||:.:...|:..|.:||.|...:|
 Worm   495 AQN--IAIPTMNPKTNSAVNLKVLGQRQKMGTTDIELLKKMYCQPGCDD 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 58/205 (28%)
ZnMc_astacin_like 110..289 CDD:239807 53/192 (28%)
nas-11NP_001024789.1 Astacin 339..537 CDD:279708 57/206 (28%)
ZnMc_astacin_like 346..534 CDD:239807 53/193 (27%)
ShK 538..575 CDD:279838 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.