DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-15

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_508154.2 Gene:nas-15 / 180426 WormBaseID:WBGene00003534 Length:571 Species:Caenorhabditis elegans


Alignment Length:243 Identity:88/243 - (36%)
Similarity:133/243 - (54%) Gaps:27/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DSDTNIWEHCGL-----FEGDIMLHR------ELLRNG-------------LLNERLTWPEAAVP 111
            |:..:||:...:     |||||....      ||..||             :.|....|||..:|
 Worm    65 DNGDDIWDSDAMYSKDRFEGDIANDNLNASTAELFANGGSGKSEDGKWYNAIKNRLQLWPEGRIP 129

  Fly   112 FYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLN 176
            :.|..| :::....:|..:.:||...||||:.|.|..|.:::.|..: .||:|.||:..|.|.|:
 Worm   130 YTISSQ-YSSYSRSLIAASMQEYASHTCIRWVPKEAADVNYVHIYPD-RGCYSMVGKMGGKQSLS 192

  Fly   177 LNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEY 241
            |.: .|:..|:::|||:||:||:|:||.|:||:::.|.|.||..|....|.||....|.:.|..|
 Worm   193 LGS-GCIQKGIILHELMHAVGFFHEQSRTDRDDHITIMWNNIQAGMQGQFEKYGHGTIQSLGTGY 256

  Fly   242 DYQSVMHYSSRAFSKNGKATIEPLDPYASLGQRRGLSDKDVSKLNEMY 289
            ||.|:|||.::|||:||:.|:.|....|::|||.|.|..|..|:|.:|
 Worm   257 DYGSIMHYGTKAFSRNGQPTMIPKKNGATIGQRNGFSKVDKFKINTLY 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 75/186 (40%)
ZnMc_astacin_like 110..289 CDD:239807 71/178 (40%)
nas-15NP_508154.2 Astacin 121..308 CDD:279708 75/187 (40%)
ZnMc_astacin_like 126..304 CDD:239807 71/180 (39%)
ShKT 354..388 CDD:214586
ShK 436..471 CDD:279838
Gag_MA <472..531 CDD:279482
ShK 535..571 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I2703
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm4854
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.