DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-38

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001359993.1 Gene:nas-38 / 180407 WormBaseID:WBGene00003554 Length:727 Species:Caenorhabditis elegans


Alignment Length:334 Identity:87/334 - (26%)
Similarity:135/334 - (40%) Gaps:86/334 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CFWSALALALSATLEASTPATRKALLRARPAVPPAARWGANMQMLRRHNS-------PAFNFWTE 70
            ||...|..:.:|.:   ..|::|.|.|.:..:...|         .|||:       ..|:....
 Worm    15 CFCCLLIFSSAARV---PKASKKHLARVKQLLNDEA---------ERHNTLIQSDSVTVFDDIQR 67

  Fly    71 DSDTNIWEHCGL--------FEGDIML------------------HRELLRNGLLNERLTW-PEA 108
            :.:|.: .|..|        |:||:.|                  .|::.||.|..:   | ...
 Worm    68 NPNTGV-HHDELAVNNADEYFQGDVDLSEQQVKIIEDQFTQGKREKRKIGRNPLYKK---WDTRG 128

  Fly   109 AVPF-YIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQG----DKHWLLIKGNYSGCWSSVGR 168
            .:.| |.:...|...|.  |..|...:...||:||   |:|    |:......|   ||.|.|||
 Worm   129 PISFDYAESIPFQTRQK--IRSAMLLWQQHTCLRF---EEGGPNVDRLEFFDGG---GCSSFVGR 185

  Fly   169 RSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTH 233
            ..|.|.::::||.|...|::.||:.||||.:|:|:..:::.::.||:.||.....:||......|
 Worm   186 VGGTQGISISTPGCDVVGIISHEIGHALGIFHEQARPDQERHIAINYNNIPLSRWNNFQAVGENH 250

  Fly   234 ITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDPY------------ASLGQRRGLSDKDVSKLN 286
            ...:.:.||..|||||....|:.         |||            :::|||.|.|..|...:|
 Worm   251 AETYNLPYDTGSVMHYGPYGFAS---------DPYTPTIRTLERVQQSTIGQRAGPSFLDYQAIN 306

  Fly   287 EMYEQDCSE 295
            ..|  .|:|
 Worm   307 MAY--GCTE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 62/208 (30%)
ZnMc_astacin_like 110..289 CDD:239807 59/195 (30%)
nas-38NP_001359993.1 Astacin 122..313 CDD:366617 62/212 (29%)
CUB 367..466 CDD:214483
TSP1 613..658 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.