DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-32

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_503351.3 Gene:nas-32 / 178595 WormBaseID:WBGene00003550 Length:653 Species:Caenorhabditis elegans


Alignment Length:345 Identity:91/345 - (26%)
Similarity:131/345 - (37%) Gaps:74/345 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FW---------SALALALSATLEASTPA-------------TRKALLRARPAVPPAAR------W 50
            ||         |..|...::|:..||.|             .||:|.:|...|||..|      .
 Worm    62 FWKWTWNSRINSTTAATPTSTVTTSTSAPTTSPRVYKLKSEARKSLRKALRGVPPEKRKKQLKKM 126

  Fly    51 GANMQMLRR-------------------HNSPAFNFWTEDSDTNIWEHCGLFEGDIMLHRELL-- 94
            |..|..:.:                   .|.||.:.:..:....:.|:  ||:|||.|:...:  
 Worm   127 GKKMMKIPKITKKESNKLHKSYRKVKITENPPALDMFEVNERAGLNEY--LFQGDINLNNNQIAK 189

  Fly    95 ------------RNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQ 147
                        :..:.|....||...|.:|.| .........::..|.......||::|.....
 Worm   190 ISSEQSSKSRRKKRQIDNLAQFWPGKVVYYYFD-SGLTTTVQQIVRDAITFLESNTCLKFELNST 253

  Fly   148 GDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVK 212
            ......:..|  .||:|..|...|.|.|:|.. .|...|...||:.|.||.:|.|..::||:||.
 Worm   254 ATNRVKIFSG--VGCYSDTGMLGGEQTLSLGY-GCEVTGTAAHEIAHTLGLFHTQMRSDRDDYVT 315

  Fly   213 INWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAF-SKNGKATIEPLDP---YASLGQ 273
            |:..::.:....||.|......||. |:|:|.|.||||.||| |..|..:|.|.||   |...| 
 Worm   316 IDLTDVPESSQQNFIKLTEATSTNL-VDYEYGSFMHYSGRAFVSSGGVDSIVPKDPVMVYTMGG- 378

  Fly   274 RRGLSDKDVSKLNEMYEQDC 293
             |.::..|:..||..|...|
 Worm   379 -RIVTFLDLKMLNTHYSCSC 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 62/194 (32%)
ZnMc_astacin_like 110..289 CDD:239807 58/182 (32%)
nas-32NP_503351.3 Astacin 210..397 CDD:279708 61/193 (32%)
ZnMc_astacin_like 214..393 CDD:239807 58/185 (31%)
CUB 464..>528 CDD:294042
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.