DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and dpy-31

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001022731.1 Gene:dpy-31 / 176014 WormBaseID:WBGene00006592 Length:592 Species:Caenorhabditis elegans


Alignment Length:262 Identity:87/262 - (33%)
Similarity:130/262 - (49%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LRRHNSPAFNFW--TEDSDTNIWEHCGLFEGDIMLHRELLRNGLLNERLT--------------- 104
            :.||.:|....|  ..||..|..|....|:|||:|:.|..: .|..:.||               
 Worm    70 IERHKNPELVAWDRKRDSVLNPEEQGKFFQGDIVLYPEQAK-ALYEQALTEGKTRVKRKFIGSNL 133

  Fly   105 --WPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVG 167
              |..:....|.........:..:|..|.:.:|:.||:.|:..:|.:....::..:..||.|:||
 Worm   134 RRWDASRPIIYAFDGSHTQREQRIIELALEHWHNITCLNFQRNDQANSGNRIVFTDVDGCASNVG 198

  Fly   168 RRSGG--QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYA 230
            |...|  |:::| .|:|:..||:.||:.|||||:|:||..:||:||.:.||||.......|.|..
 Worm   199 RHPLGEEQLVSL-APECIRLGVIAHEVAHALGFWHEQSRPDRDQYVTVRWENIDKDSKGQFLKED 262

  Fly   231 RTHITNFGVEYDYQSVMHYSSRAFSK-NGKATIEP--LDPYASLGQRRGLSDKDVSKLNEMYEQD 292
            ...:.|.||.|||.|:|||.|:|||| :...||..  .|...::|||..||..|:..:|::|   
 Worm   263 PDDVDNAGVPYDYGSIMHYRSKAFSKFDDLYTISTYVTDYQKTIGQRDQLSFNDIRLMNKIY--- 324

  Fly   293 CS 294
            ||
 Worm   325 CS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 71/213 (33%)
ZnMc_astacin_like 110..289 CDD:239807 66/183 (36%)
dpy-31NP_001022731.1 Astacin 134..327 CDD:279708 70/197 (36%)
ZnMc_astacin_like 139..324 CDD:239807 66/185 (36%)
CUB 383..483 CDD:214483
TSP1 493..539 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.