DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-25

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_495880.1 Gene:nas-25 / 174412 WormBaseID:WBGene00003544 Length:399 Species:Caenorhabditis elegans


Alignment Length:212 Identity:70/212 - (33%)
Similarity:100/212 - (47%) Gaps:29/212 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 WPEAAVPFYIDPQDFNANQTMVILK----AFKEYHDRTCIRFR----PYEQGDKHWLLIKGNYSG 161
            ||...||:|:      .|.|..|.|    |.:|....|||||:    .|..||...::..|:   
 Worm    50 WPNNTVPYYV------GNVTSTIKKSVRLAIEELQAWTCIRFQNVNEKYSDGDSVRIVDLGS--- 105

  Fly   162 CWSSVGRRS-GGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHN 225
            |.|.:||:. |.|.::| |..|...|..:|||:||:|..|.||.::|:.|:.|..:||.:....|
 Worm   106 CSSPIGRQQIGTQDVSL-TKNCWGMGTAIHELMHAIGIEHTQSRSDRNRYLDILAQNIDNRDLPN 169

  Fly   226 FNKYARTHITNFGVEYDYQSVMHYSSRAFS-KNGKATIEPLDPYASLGQRRGLSDKDVSKLNEMY 289
            |...:.....|. |.|||.||||||:.:|| |:.:.|:.|.|        |...:...|.:...|
 Worm   170 FELLSPRLWANL-VPYDYGSVMHYSADSFSNKDDEQTMLPKD--------RSFIETMGSMIPNFY 225

  Fly   290 EQDCSEDYLLNFDRFGN 306
            :.|....|...:|...|
 Worm   226 DFDQINQYYQCYDSCRN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 67/199 (34%)
ZnMc_astacin_like 110..289 CDD:239807 63/188 (34%)
nas-25NP_495880.1 Astacin 48..236 CDD:279708 68/204 (33%)
ZnMc_astacin_like 52..234 CDD:239807 65/200 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.