DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Mep1b

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_032612.2 Gene:Mep1b / 17288 MGIID:96964 Length:704 Species:Mus musculus


Alignment Length:226 Identity:92/226 - (40%)
Similarity:130/226 - (57%) Gaps:13/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFEGDIMLHRELLRNGLLNERLTWPEAAVPFYI-DPQDFNANQTMVILKAFKEYHDRTCIRFRPY 145
            ||||||.|... .:|.::.:...||. .:|:.: |..:.||..  |||.||:.|..:|||.|:|:
Mouse    50 LFEGDIKLEAN-GKNSIIGDHKRWPH-TIPYVLEDSLEMNAKG--VILNAFERYRLKTCIDFKPW 110

  Fly   146 EQGDKHWL-LIKGNYSGCWSSVGR-RSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERD 208
             .|:.::: :.||  ||||||||. .:|.|.|::.| .|.....|.||.||||||:|:||..:||
Mouse   111 -SGEANYISVFKG--SGCWSSVGNIHAGKQELSIGT-NCDRIATVQHEFLHALGFWHEQSRADRD 171

  Fly   209 EYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATI-EPLDPYAS-L 271
            :||.|.|:.|..|..||||.|..:...:..|.|||.||||||..||....::|| ..:..:.. :
Mouse   172 DYVIIVWDRIQPGKEHNFNIYNDSVSDSLNVPYDYTSVMHYSKTAFQNGTESTIVTRISEFEDVI 236

  Fly   272 GQRRGLSDKDVSKLNEMYEQDCSEDYLLNFD 302
            |||...||.|:.|||::|....|..::.:.|
Mouse   237 GQRMDFSDYDLLKLNQLYNCTSSLSFMDSCD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 82/195 (42%)
ZnMc_astacin_like 110..289 CDD:239807 79/183 (43%)
Mep1bNP_032612.2 ZnMc 30..256 CDD:294052 90/213 (42%)
Astacin 70..258 CDD:279708 82/194 (42%)
MAM 266..430 CDD:279023 1/2 (50%)
MAM 266..428 CDD:99706 1/2 (50%)
MATH 428..587 CDD:295307
EGF_CA 609..647 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4395
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H48382
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8881
orthoMCL 1 0.900 - - OOG6_108702
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2664
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.