DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Mep1a

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_032611.2 Gene:Mep1a / 17287 MGIID:96963 Length:760 Species:Mus musculus


Alignment Length:243 Identity:86/243 - (35%)
Similarity:132/243 - (54%) Gaps:23/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DSDTNIWEH-----------CGLFEGDIMLHRELLRNGLLNERLTWPEAAVPFYIDPQDFNANQT 124
            |.||::.|.           ..||:|||:|.|  .||.:.:....| :..:| ||...:...|..
Mouse    44 DHDTDVGEQKDIFEINLAAGLNLFQGDILLPR--TRNAMRDPSSRW-KLPIP-YILADNLELNAK 104

  Fly   125 MVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVV 189
            ..||.||:.:..::|:.|:||| |:..:::.: ..|||||.:|.:..||.:::. ..|.....:.
Mouse   105 GAILHAFEMFRLKSCVDFKPYE-GESSYIIFQ-KLSGCWSMIGDQQVGQNISIG-EGCDFKATIE 166

  Fly   190 HELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAF 254
            ||:||||||:|:||.|:||:||.|.|:.|:..:.||||.|....||:....|||:|:|||...:|
Mouse   167 HEILHALGFFHEQSRTDRDDYVNIWWDQIITDYEHNFNTYDDNTITDLNTPYDYESLMHYGPFSF 231

  Fly   255 SKNGK-ATIEPLDPYAS--LGQRRGLSDKDVSKLNEMYEQDCSEDYLL 299
            :||.. .||....|..:  :||....|..|:.:||.||  :|:..:.|
Mouse   232 NKNESIPTITTKIPEFNTIIGQLPDFSAIDLIRLNRMY--NCTATHTL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 72/193 (37%)
ZnMc_astacin_like 110..289 CDD:239807 68/181 (38%)
Mep1aNP_032611.2 ZnMc 46..271 CDD:381785 83/233 (36%)
MAM 281..444 CDD:366209
MATH 443..607 CDD:351761
EGF 688..722 CDD:333761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I4395
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6774
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8881
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.