DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and nas-36

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_492109.2 Gene:nas-36 / 172506 WormBaseID:WBGene00003552 Length:617 Species:Caenorhabditis elegans


Alignment Length:249 Identity:76/249 - (30%)
Similarity:111/249 - (44%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LFEGDIMLHR----------------ELLRNGLLNERLTWP--------EAAVPFYIDPQDFNAN 122
            ||||||.|.|                .|.|:.:.::..||.        ..::.||...|     
 Worm    97 LFEGDIFLSRRQAVDILKALSKDKTKRLRRSFVSDKTATWKTMPIKYRFHESIDFYTISQ----- 156

  Fly   123 QTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNY------SGCWSSVGRRSGGQVLNLNTPK 181
                |:.|.:.:.|.|||.|.......      .|:|      .||:|.:||..|.|.:::. ..
 Worm   157 ----IIAAIRFWEDSTCITFENVSDSP------DGDYIEFFSGQGCYSMIGRNGGRQGISIG-ES 210

  Fly   182 CVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSV 246
            ||..||:.||:.||||.:|:||..:...||.|..:.||..:..:|.: ....|...|:.||..||
 Worm   211 CVKMGVIEHEIGHALGLWHEQSRPDALGYVTIERDFILPSYISDFLQ-RDDEIDTLGIPYDLGSV 274

  Fly   247 MHYSSRAFSKNGKA-TIEPLDP--YASLGQRRGLSDKDVSKLNEMY-EQDCSED 296
            |||.|.|||.:.|: |:...|.  ..::|||..||..||:.:|..| :.:|..:
 Worm   275 MHYGSTAFSVDQKSKTVVTRDSLYQQTIGQREKLSFYDVATINTAYCKDECKSE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 66/208 (32%)
ZnMc_astacin_like 110..289 CDD:239807 62/187 (33%)
nas-36NP_492109.2 Astacin 134..323 CDD:279708 65/205 (32%)
ZnMc_astacin_like 140..320 CDD:239807 62/196 (32%)
CUB 380..478 CDD:214483
TSP1 510..556 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.