DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and LOC105946018

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_031756313.1 Gene:LOC105946018 / 105946018 -ID:- Length:583 Species:Xenopus tropicalis


Alignment Length:207 Identity:70/207 - (33%)
Similarity:111/207 - (53%) Gaps:13/207 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RNGLLNERLTWPE----AAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLI 155
            |:.:.:....|.:    ..||:.:|.: ::.::...:..|.:.|...||::|.||...|.:..:.
 Frog   150 RSAITSTECLWQKTNETVYVPYTLDSK-YSNSEVNTMTSAMEVYATLTCVQFVPYTDEDDYVNIT 213

  Fly   156 KGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILD 220
            .|:  ||||.:||:.|.||:::....|.:.|..:|||.|||||.|:.|.::||.||.|.::.|..
 Frog   214 SGD--GCWSYMGRQGGAQVVSVEKGYCTSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISP 276

  Fly   221 GHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSK-NGKATI-EPLDPYASLGQRRGLSDKDVS 283
            |...||.   ..:..|....|||:|:|||.:.|||. .||.|| ..|:|...:|....::..|:.
 Frog   277 GDIVNFE---IMNTNNLNTIYDYRSIMHYPAWAFSNTTGKNTIVAKLNPNIIIGAGSTMTSLDII 338

  Fly   284 KLNEMYEQD-CS 294
            |:|.:||.| ||
 Frog   339 KINRLYECDVCS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 69/198 (35%)
ZnMc_astacin_like 110..289 CDD:239807 63/180 (35%)
LOC105946018XP_031756313.1 C2 92..>113 CDD:417471
ZnMc 164..346 CDD:412141 64/187 (34%)
CUB 349..458 CDD:395345 2/2 (100%)
CUB 463..574 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.