DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and astl3a.3

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_031746774.1 Gene:astl3a.3 / 100498584 XenbaseID:XB-GENE-22069675 Length:529 Species:Xenopus tropicalis


Alignment Length:280 Identity:107/280 - (38%)
Similarity:149/280 - (53%) Gaps:18/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LEASTPATRKALLRARPAVPPAARWGANMQMLRRHNSPAFNFWTEDSDTNIWEHCGLFEGDIMLH 90
            |||...:..|..|.....|.     |..|.:|.: .|.:.:.:|:.|..|.......::|||:  
 Frog    45 LEALGKSAEKDALATEGTVR-----GMEMPVLGK-KSGSVDVFTQISKVNRGIRVPTYQGDIL-- 101

  Fly    91 RELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFK----EYHDRTCIRFRPYEQGDKH 151
            |...|:.:......||::.....|.|.:|::|.:...|..||    ||...||:||.|.......
 Frog   102 RPKGRSAMNCTECLWPKSTDGTVIVPYNFSSNYSADQLALFKSTMQEYESLTCVRFVPRANETDF 166

  Fly   152 WLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWE 216
            ..::..|  ||.|.:|:..|.|.:.|::..|:..|::.|||.|||||||:||.::||:||.|:.|
 Frog   167 LSIVSDN--GCASFLGKVGGDQTVQLDSYGCIYRGIIQHELNHALGFYHEQSRSDRDDYVTIHTE 229

  Fly   217 NILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPL-DPYASLGQRRGLSDK 280
            ||:.|:..||||   ....|.|:||||.||||||..||||||..||.|. ||...:|||.|||..
 Frog   230 NIIPGYEGNFNK---ADSNNLGLEYDYSSVMHYSGDAFSKNGNLTIVPKPDPTVPIGQRDGLSIL 291

  Fly   281 DVSKLNEMYEQDCSEDYLLN 300
            ||||:|.:|:.|...:.|.|
 Frog   292 DVSKINRLYQCDVCSNLLSN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 87/195 (45%)
ZnMc_astacin_like 110..289 CDD:239807 83/183 (45%)
astl3a.3XP_031746774.1 ZnMc_hatching_enzyme 121..302 CDD:239810 84/185 (45%)
CUB 306..414 CDD:238001 2/6 (33%)
CUB 419..527 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4121
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.