DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and syt13

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_002937348.3 Gene:syt13 / 100496122 XenbaseID:XB-GENE-955112 Length:508 Species:Xenopus tropicalis


Alignment Length:298 Identity:97/298 - (32%)
Similarity:154/298 - (51%) Gaps:44/298 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LICFWSALALALSATLE----ASTPATRKALLRARPAVPPAARWGANMQMLRRHNSPAFNFWTED 71
            |:|   ....|||..||    ..:|:..:.::|.:|...|......:::.:.:            
 Frog    10 LLC---VSGTALSRPLELLQFLDSPSGGETIVRDQPEGLPIEDIIGSIEKMNK------------ 59

  Fly    72 SDTNIWEHCGLFEGDIML--HRELLRNGLLNERLTWPEAA-----VPFYIDPQDFNANQTMVILK 129
            ..|.:.:|     ||:.:  .|..:|  ..::...||::|     ||:.: ..::|......|..
 Frog    60 GRTRLLQH-----GDMAIPTGRSAIR--CTSKDCYWPKSANGLVNVPYTL-AAEYNVQDRATIAA 116

  Fly   130 AFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRR-SGGQVLNLNTPKCVTHGVVVHELL 193
            |..|:...|||||.|: ..::.:|.|..: |||||.:||. .|||.|:|....|:::|::.|||.
 Frog   117 AMLEFSTLTCIRFVPH-TNERDFLNIISD-SGCWSFLGRAGGGGQDLSLQRGGCLSNGIIQHELN 179

  Fly   194 HALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNG 258
            |||||.|:.:.::||.||||.|.||...:..:|||   |...|.|:||||.|||||...::|.:.
 Frog   180 HALGFVHEHTRSDRDSYVKIFWNNIQPEYKDSFNK---TDTDNQGMEYDYGSVMHYGRNSYSIDY 241

  Fly   259 K-ATIEPL-DPYASLGQRRGLSDKDVSKLNEMYEQDCS 294
            : .||:|: :....:|||.|||..|.:|:|.:|  :||
 Frog   242 QLPTIQPIPNGLIPIGQRYGLSSLDAAKINRLY--NCS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 80/199 (40%)
ZnMc_astacin_like 110..289 CDD:239807 74/181 (41%)
syt13XP_002937348.3 ZnMc_hatching_enzyme 93..276 CDD:239810 75/190 (39%)
CUB 294..388 CDD:238001
CUB 391..504 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.