DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and astl2d.1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_004913424.2 Gene:astl2d.1 / 100495740 XenbaseID:XB-GENE-22069737 Length:604 Species:Xenopus tropicalis


Alignment Length:194 Identity:73/194 - (37%)
Similarity:111/194 - (57%) Gaps:13/194 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 VPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQV 174
            ||:.:|.| ::.|:...|:.|.:.|...||::|.||...|.:..:..|:  ||||.:||:.|.||
 Frog   196 VPYTLDEQ-YSNNEVNTIMTAMQVYATLTCVQFVPYTDEDDYIAITSGD--GCWSYMGRQGGAQV 257

  Fly   175 LNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGV 239
            :::....|.:.|..:|||.|||||.|:.|.::||.||.|.::.|..|...||.|   .:..|...
 Frog   258 VSVQKTYCTSEGTTMHELNHALGFVHEHSRSDRDNYVDIMYQYISPGDVANFEK---MNTNNLNT 319

  Fly   240 EYDYQSVMHYSSRAFSK-NGKATI--EPLDPYASLGQRRGLSDKDVSKLNEMYEQD-CSEDYLL 299
            .|||.|:|||::.:||. .|:.||  :| ||...||....::..|::|:|.:|:.| ||  |.|
 Frog   320 AYDYHSIMHYAAYSFSNTTGQNTIVAKP-DPNTPLGPGSTMTSLDITKINRLYQCDVCS--YFL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 70/188 (37%)
ZnMc_astacin_like 110..289 CDD:239807 67/181 (37%)
astl2d.1XP_004913424.2 ZnMc_hatching_enzyme 191..373 CDD:239810 68/183 (37%)
CUB 376..485 CDD:395345 4/7 (57%)
CUB 490..601 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.