DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and astl2d.5

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_031756347.1 Gene:astl2d.5 / 100495579 XenbaseID:XB-GENE-22069752 Length:497 Species:Xenopus tropicalis


Alignment Length:211 Identity:73/211 - (34%)
Similarity:113/211 - (53%) Gaps:20/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 GLLNERLTWPEAA---------VPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKHW 152
            |:....:|:.|..         ||:.:|.: ::.::...:..|.:.|...||::|.||...|.:.
 Frog    66 GVSRSAITYTECLWQKTNGTVYVPYTLDDK-YSNSEVNTMTSAMEVYATLTCVQFVPYTDEDDYV 129

  Fly   153 LLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWEN 217
            .:..|:  ||||.:||:.|.||:::....|.:.|..:|||.|||||.|:||.::||.||.|.::.
 Frog   130 NITSGD--GCWSYMGRQRGAQVVSVEKGYCTSEGTTMHELNHALGFVHEQSRSDRDNYVNIMYQY 192

  Fly   218 ILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSK-NGKATI--EPLDPYASLGQRRGLSD 279
            |..|....|.|   ....|.|..|||:|||||.:.|||. .|:.||  :| :|...:|....::.
 Frog   193 ISPGDVAEFKK---MESNNLGTTYDYRSVMHYPAWAFSNTTGQNTIVAKP-NPNIIIGAGNTMTS 253

  Fly   280 KDVSKLNEMYEQD-CS 294
            .|:.|:|.:||.| ||
 Frog   254 LDIIKINRLYECDVCS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 72/204 (35%)
ZnMc_astacin_like 110..289 CDD:239807 65/181 (36%)
astl2d.5XP_031756347.1 ZnMc 83..265 CDD:412141 66/188 (35%)
CUB 268..377 CDD:395345 2/2 (100%)
CUB 382..493 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.