DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and astl2f

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_002934133.3 Gene:astl2f / 100495416 XenbaseID:XB-GENE-22069764 Length:624 Species:Xenopus tropicalis


Alignment Length:246 Identity:90/246 - (36%)
Similarity:130/246 - (52%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DSDTNIWEHCGLFEGDIMLHRELLRNGLLN-ERLTWPEAA-----VPFYIDPQDFNANQTMVILK 129
            :.|||:    .|.:|||:   |.|.....| ....||.|.     ||:.| ...|:.::..:|..
 Frog   175 NKDTNV----PLVQGDIL---EKLGRSTTNCTSCLWPRATSGLVNVPYTI-ASVFDDSEQELIQG 231

  Fly   130 AFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLH 194
            |..|....:||||:.............||  |||||||:..|.|.::::...|::||::.||.||
 Frog   232 ALNELMTLSCIRFKARTIETDFLSFQSGN--GCWSSVGKTGGSQEVSVSKSGCMSHGIIQHETLH 294

  Fly   195 ALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKN-G 258
            ||||.|:...::||.||.|.::.|.:|...:|.|   .:..|.|::|||.|||||....|:.. |
 Frog   295 ALGFIHEHCRSDRDNYVDIIYKYISEGDRSSFTK---VNSNNLGLQYDYSSVMHYGRFTFTNTPG 356

  Fly   259 KATIEPL-DPYASLGQRRGLSDKDVSKLNEMYEQD-CSEDYLLNFDRFGNY 307
            :|||.|. |....:|||.|:|..||:|||::|..: ||.  ||: |..|.:
 Frog   357 QATIIPKPDLSVPIGQRYGVSSLDVAKLNKLYNCNICSN--LLS-DTSGTF 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 75/198 (38%)
ZnMc_astacin_like 110..289 CDD:239807 70/180 (39%)
astl2fXP_002934133.3 ZnMc 209..390 CDD:412141 71/186 (38%)
CUB 394..504 CDD:238001 5/14 (36%)
CUB 507..621 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.