DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and astl2g

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_002934115.1 Gene:astl2g / 100491886 XenbaseID:XB-GENE-22069768 Length:505 Species:Xenopus tropicalis


Alignment Length:296 Identity:105/296 - (35%)
Similarity:145/296 - (48%) Gaps:41/296 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SALIVPGLI-CFWSALALALSATLEASTPATRKALLRARPAVPPAARWGANMQMLRRHNSPAFNF 67
            |.|||..|: |.       |.|.||.......|..:....|.|...                 :.
 Frog     6 SCLIVASLMQCI-------LGAPLEIYFEEANKIAVSQEEAKPEPK-----------------DV 46

  Fly    68 WTEDSDTNIWEHCGLFEGDIMLHRELLRNGLL--NERLTWPEA----AVPFYIDPQDFNANQTMV 126
            :|..|:||......|.|.||::..:  ||.:.  .:...|..:    .||:.|. .:|:|.:..|
 Frog    47 FTIISETNKGVKKLLHESDIVVSVD--RNAMKCDGDTCRWKTSDGIVRVPYTIS-ANFSATEVSV 108

  Fly   127 ILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHE 191
            |:.|.:::...||:.|.|......:..:|..  |||||.||:..|.|.::||...||..|.|.||
 Frog   109 IVDAMQDFATLTCVNFVPRTVEPDYLQIIPD--SGCWSYVGKTGGAQEVSLNQGGCVGKGTVQHE 171

  Fly   192 LLHALGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSK 256
            |.|||||||:||.::||.||.|...||:.....||:||   :..|.|.||||.|||||...||:|
 Frog   172 LNHALGFYHEQSRSDRDNYVNILTGNIIPASIGNFDKY---NTNNLGQEYDYSSVMHYGRNAFAK 233

  Fly   257 N-GKATIEPL-DPYASLGQRRGLSDKDVSKLNEMYE 290
            . |..||.|. :|...:|||.|||:.|:||:|::|:
 Frog   234 QPGLDTIVPKPNPNVPIGQRYGLSNLDISKINQLYQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 82/193 (42%)
ZnMc_astacin_like 110..289 CDD:239807 80/180 (44%)
astl2gXP_002934115.1 Astacin 83..272 CDD:279708 82/193 (42%)
ZnMc_hatching_enzyme 88..270 CDD:239810 81/188 (43%)
CUB 270..384 CDD:238001 105/296 (35%)
CUB 387..497 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4121
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.