DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and astl3c

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_002937470.2 Gene:astl3c / 100491451 XenbaseID:XB-GENE-22069695 Length:533 Species:Xenopus tropicalis


Alignment Length:215 Identity:86/215 - (40%)
Similarity:130/215 - (60%) Gaps:16/215 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 GDIMLHRELLRNGLLNERLTWPEAA-----VPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRP 144
            |||:::  :.|:...::.| ||::|     || ||...:::|::..:...|.:|:...||:||.|
 Frog    77 GDILIN--IGRSATSSDYL-WPKSADGTVVVP-YIFSYNYSADELTLFKTAMQEFETLTCVRFVP 137

  Fly   145 YEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDE 209
             :...:.:|.|..| .||.|.|||..|||.:.|.:..|::.||:.|||.|||||||:...::||:
 Frog   138 -KTIQRDFLNIVSN-GGCLSMVGRNGGGQKVELASYGCMSRGVIQHELNHALGFYHEHMRSDRDD 200

  Fly   210 YVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFS-KNGKATIEPL-DPYASLG 272
            ||.|..|||:..:.:.|:| .:|:  |.|:.|||.||||||...|| ...|:||.|. ||...:|
 Frog   201 YVTIITENIIPSYENYFSK-RKTN--NMGIIYDYNSVMHYSRNTFSISPDKSTIVPKPDPSIPIG 262

  Fly   273 QRRGLSDKDVSKLNEMYEQD 292
            ||.|||..|:.|:.::|:.|
 Frog   263 QRDGLSILDILKIKKLYQCD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 81/196 (41%)
ZnMc_astacin_like 110..289 CDD:239807 76/180 (42%)
astl3cXP_002937470.2 ZnMc 99..281 CDD:381785 77/187 (41%)
CUB 290..393 CDD:366096
CUB 398..508 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4121
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.